PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK28725.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB
Protein Properties Length: 191aa    MW: 21817.7 Da    PI: 8.809
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK28725.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding605.2e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l+d+++++G g+W+t ++  g+ R++k+c++rw +yl
       KFK28725.1 14 KGPWTSEEDQKLIDYIQKHGYGNWRTLPKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding53.36.5e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
       KFK28725.1  67 RGRFSFEEEETIIQLHSFLGNK-WSAIAARLP-GRTDNEIKNFWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.2E-27564IPR009057Homeodomain-like
PROSITE profilePS5129424.797965IPR017930Myb domain
SuperFamilySSF466895.87E-3211108IPR009057Homeodomain-like
SMARTSM007173.3E-131363IPR001005SANT/Myb domain
PfamPF002499.8E-171461IPR001005SANT/Myb domain
CDDcd001676.54E-121661No hitNo description
Gene3DG3DSA:1.10.10.601.9E-2665116IPR009057Homeodomain-like
PROSITE profilePS5129419.23466116IPR017930Myb domain
SMARTSM007171.4E-1566114IPR001005SANT/Myb domain
PfamPF002492.5E-1567111IPR001005SANT/Myb domain
CDDcd001674.55E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MGRSPCCEKN GLKKGPWTSE EDQKLIDYIQ KHGYGNWRTL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIQ LHSFLGNKWS AIAARLPGRT DNEIKNFWNT HIRKKLLRMG  120
IDPVTHNQSF NLANSVLTTP SSSPSPTTLN SSSTTYINSS SCSTEDEMES YCSNLMKFDI  180
PDFLDVNGFI I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-311211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196071e-148AY519607.1 Arabidopsis thaliana MYB transcription factor (At4g21440) mRNA, complete cds.
GenBankBT0012351e-148BT001235.1 Arabidopsis thaliana myb-related protein M4 (At4g21440) mRNA, complete cds.
GenBankX903821e-148X90382.2 Arabidopsis thaliana mRNA for putative transcription factor (MYB102 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_567626.11e-92R2R3 family MYB transcription factor
SwissprotQ8GWP01e-69MYB39_ARATH; Transcription factor MYB39
SwissprotQ9S9K92e-70MYB3_ARATH; Transcription factor MYB3
TrEMBLA0A087GFS31e-142A0A087GFS3_ARAAL; Uncharacterized protein
STRINGAT4G21440.13e-92(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.14e-94MYB-like 102